Shopping Cart
- Remove All
Your shopping cart is currently empty
Pterinotoxin-1 is a peptide toxin that functions as an inhibitor of sodium channels [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Pterinotoxin-1 is a peptide toxin that functions as an inhibitor of sodium channels [1]. |
| Molecular Weight | 3969.49 |
| Formula | C163H251N49O53S7 |
| Sequence | Asp-Asp-Cys-Leu-Gly-Met-Phe-Ser-Ser-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Arg-Lys-Cys-Asn-Arg-Lys-Asp-Lys-Trp-Cys-Lys-Tyr-Val-Leu-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30) |
| Sequence Short | DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL-NH2 (Disulfide bridge: Cys3-Cys18,Cys10-Cys23,Cys17-Cys30) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.