Your shopping cart is currently empty

PINT-87aa TFA is an 87-amino acid (aa) peptide encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). It interacts directly with the polymerase-associated factor complex (PAF1c) to inhibit the transcriptional elongation of numerous oncogenes, effectively suppressing glioblastoma cell proliferation both in vitro and in vivo [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | PINT-87aa TFA is an 87-amino acid (aa) peptide encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). It interacts directly with the polymerase-associated factor complex (PAF1c) to inhibit the transcriptional elongation of numerous oncogenes, effectively suppressing glioblastoma cell proliferation both in vitro and in vivo [1]. |
| Molecular Weight | 9721.05 |
| Formula | C396H628N140O115S13.C2HF3O2 |
| Sequence | Met-Leu-Trp-Leu-Pro-Asp-Arg-Gly-Ser-Cys-Ser-Ala-Arg-Ser-Pro-Ser-Gly-Met-Leu-Arg-Gly-Ala-Pro-Gly-Gly-Trp-Arg-Tyr-Gly-Arg-Arg-Cys-Gly-Arg-Arg-Arg-Gln-Ser-Cys-Cys-Cys-Cys-Cys-Cys-Cys-Ser-His-Val-Gly-Ala-Pro-Leu-Ser-Phe-His-Arg-Glu-Ala-Ser-Leu-Val-Ser-His-Asp-Gly-His-Asp-Ile-Met-Lys-Gln-His-Cys-Gly-Glu-Glu-Ser-Ile-Arg-Gly-Ala-His-Gly-Tyr-Lys-Asn-Lys |
| Sequence Short | MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.