Shopping Cart
- Remove All
- Your shopping cart is currently empty
PINT-87aa TFA is an 87-amino acid (aa) peptide encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). It interacts directly with the polymerase-associated factor complex (PAF1c) to inhibit the transcriptional elongation of numerous oncogenes, effectively suppressing glioblastoma cell proliferation both in vitro and in vivo [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | PINT-87aa TFA is an 87-amino acid (aa) peptide encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). It interacts directly with the polymerase-associated factor complex (PAF1c) to inhibit the transcriptional elongation of numerous oncogenes, effectively suppressing glioblastoma cell proliferation both in vitro and in vivo [1]. |
Molecular Weight | 9721.05 |
Formula | C396H628N140O115S13.C2HF3O2 |
Sequence | Met-Leu-Trp-Leu-Pro-Asp-Arg-Gly-Ser-Cys-Ser-Ala-Arg-Ser-Pro-Ser-Gly-Met-Leu-Arg-Gly-Ala-Pro-Gly-Gly-Trp-Arg-Tyr-Gly-Arg-Arg-Cys-Gly-Arg-Arg-Arg-Gln-Ser-Cys-Cys-Cys-Cys-Cys-Cys-Cys-Ser-His-Val-Gly-Ala-Pro-Leu-Ser-Phe-His-Arg-Glu-Ala-Ser-Leu-Val-Ser-His-Asp |
Sequence Short | MLWLPDRGSCSARSPSGMLRGAPGGWRYGRRCGRRRQSCCCCCCCSHVGAPLSFHREASLVSHDGHDIMKQHCGEESIRGAHGYKNK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.