Shopping Cart
Remove All
Your shopping cart is currently empty
Potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 100 μg | $1,280 | 35 days | 35 days |
| Description | Potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner. |
| Targets&IC50 | Nav1.3:42 nM, Nav1.1:288 nM, Nav1.5:610 nM, Nav1.2:0.6 nM, Nav1.4:72 nM |
| Molecular Weight | 4059.74 |
| Formula | C176H269N51O48S6 |
| Cas No. | 880886-00-0 |
| Relative Density. | 1.31g/cm3 |
| Sequence Short | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.25 mM) |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.