Shopping Cart
- Remove All
- Your shopping cart is currently empty
Potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
100 μg | TBD | 35 days |
Description | Potent blocker of voltage-gated sodium channels (IC50 values are 0.6, 42, and 72 nM for NaV1.2, NaV1.3 and NaV1.5 respectively). Blocks inward sodium currents in a voltage-dependent manner. |
Targets&IC50 | Nav1.4:72 nM, Nav1.1:288 nM, Nav1.5:610 nM, Nav1.2:0.6 nM, Nav1.3:42 nM |
Molecular Weight | 4059.74 |
Formula | C176H269N51O48S6 |
Cas No. | 880886-00-0 |
Relative Density. | 1.31g/cm3 |
Sequence Short | DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.25 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.