Your shopping cart is currently empty

Phrixotoxin 3 TFA is a potent inhibitor of voltage-gated sodium channels, with IC50 values of 0.6 nM for NaV1.2, 42 nM for NaV1.3, 72 nM for NaV1.4, 288 nM for NaV1.1, and 610 nM for NaV1.5. This compound modulates the activity of these channels similarly to traditional gating-modifier toxins, inducing a depolarizing shift in gating kinetics and obstructing the inward sodium current.
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Phrixotoxin 3 TFA is a potent inhibitor of voltage-gated sodium channels, with IC50 values of 0.6 nM for NaV1.2, 42 nM for NaV1.3, 72 nM for NaV1.4, 288 nM for NaV1.1, and 610 nM for NaV1.5. This compound modulates the activity of these channels similarly to traditional gating-modifier toxins, inducing a depolarizing shift in gating kinetics and obstructing the inward sodium current. |
| Molecular Weight | 4173.74 |
| Formula | C178H270F3N51O50S6 |
| Sequence | H-DL-Asp-DL-Cys(1)-DL-Leu-Gly-DL-Phe-DL-Leu-DL-Trp-DL-Lys-DL-Cys(2)-DL-Asn-DL-Pro-DL-Ser-DL-Asn-DL-Asp-DL-Lys-DL-Cys(3)-DL-Cys(1)-DL-Arg-DL-Pro-DL-Asn-DL-Leu-DL-Val-DL-Cys(2)-DL-Ser-DL-Arg-DL-Lys-DL-Asp-DL-Lys-DL-Trp-DL-Cys(3)-DL-Lys-DL-Tyr-DL-Gln-DL-xiIle-OH |
| Sequence Short | DCLGFLWKCNSNDKCCRPNLVCSRKDKWCKYQI (Disulfide bridge:Cys2-Cys17;Cys9-Cys23;Cys16-Cys30) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.