Shopping Cart
- Remove All
Your shopping cart is currently empty
Phlo1b (μ-TrTx-Phlo1b), a 35-amino acid peptide toxin, selectively inhibits Nav1.7 channels with minimal inhibition of Nav1.2 and Nav1.5 [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Phlo1b (μ-TrTx-Phlo1b), a 35-amino acid peptide toxin, selectively inhibits Nav1.7 channels with minimal inhibition of Nav1.2 and Nav1.5 [1]. |
| Synonyms | μ-TrTx-Phlo1b |
| Molecular Weight | 4140.71 |
| Formula | C181H260N52O49S6 |
| Sequence | Ala-Cys-Arg-Glu-Leu-Leu-Gly-Gly-Cys-Ser-Lys-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Glu-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Val-Trp-Asp-Trp-Thr-Phe-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
| Sequence Short | ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTF-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.