Shopping Cart
- Remove All
- Your shopping cart is currently empty
Phlo1a (μ-TrTx-Phlo1a), a 35-amino acid peptide toxin, demonstrates a weak inhibitory effect on Nav1.2 and Nav1.5 channels [1]. Meanwhile, Phlo1b acts as a selective inhibitor of the Nav1.7 channel.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Phlo1a (μ-TrTx-Phlo1a), a 35-amino acid peptide toxin, demonstrates a weak inhibitory effect on Nav1.2 and Nav1.5 channels [1]. Meanwhile, Phlo1b acts as a selective inhibitor of the Nav1.7 channel. |
Synonyms | μ-TrTx-Phlo1a |
Molecular Weight | 4106.69 |
Formula | C178H262N52O49S6 |
Sequence | Ala-Cys-Arg-Glu-Leu-Leu-Gly-Gly-Cys-Ser-Lys-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Glu-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Val-Trp-Asp-Trp-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
Sequence Short | ACRELLGGCSKDSDCCAHLECRKKWPYHCVWDWTI-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.