Shopping Cart
- Remove All
- Your shopping cart is currently empty
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $364 | Backorder |
Description | Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo. |
Synonyms | Parstatin (human) |
Molecular Weight | 4467.29 |
Formula | C191H330N64O53S3 |
Cas No. | 1065755-99-8 |
Relative Density. | no data available |
Sequence Short | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.22 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.