Shopping Cart
Remove All
Your shopping cart is currently empty
Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $364 | Inquiry | Inquiry |
| Description | Cell-permeable peptide cleaved from protease-activated receptor 1 (PAR1) upon receptor activation. Attenuates endothelial cell migration and proliferation (IC50 ~ 3 μM), and induces cell cycle arrest. Promotes activation of caspase-3 and exhibits pro-apoptotic activity in vitro. Inhibits angiogenesis and exhibits cardioprotective activity in vivo. |
| Synonyms | Parstatin (human) |
| Molecular Weight | 4467.29 |
| Formula | C191H330N64O53S3 |
| Cas No. | 1065755-99-8 |
| Relative Density. | no data available |
| Sequence | H-Met-Gly-Pro-Arg-Arg-Leu-Leu-Leu-Val-Ala-Ala-Cys-Phe-Ser-Leu-Cys-Gly-Pro-Leu-Leu-Ser-Ala-Arg-Thr-Arg-Ala-Arg-Arg-Pro-Glu-Ser-Lys-Ala-Thr-Asn-Ala-Thr-Leu-Asp-Pro-Arg-OH |
| Sequence Short | MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.22 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.