Shopping Cart
- Remove All
- Your shopping cart is currently empty
Parathyroid Hormone (1-34), bovine TFA, a potent agonist of the parathyroid hormone (PTH) receptor, elevates calcium and inorganic phosphate levels in vivo and is used in osteoporosis research [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Parathyroid Hormone (1-34), bovine TFA, a potent agonist of the parathyroid hormone (PTH) receptor, elevates calcium and inorganic phosphate levels in vivo and is used in osteoporosis research [1]. |
Molecular Weight | 4222.79 |
Formula | C185H289F3N54O52S2 |
Sequence Short | AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.