Shopping Cart
Remove All
Your shopping cart is currently empty
Parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $1,430 | 35 days | 35 days |
| Description | Parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats. |
| Molecular Weight | 4057.74 |
| Formula | C180H291N55O48S2 |
| Cas No. | 98614-76-7 |
| Relative Density. | no data available |
| Sequence | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe |
| Sequence Short | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: 1 mg/mL (0.25 mM), Sonication is recommended. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.