Shopping Cart
- Remove All
- Your shopping cart is currently empty
Prostatic Acid Phosphatase (248-286), or PAP (248-286), is a biologically active peptide and a semen-derived enhancer of viral infection (SEVI) factor present in semen. It significantly amplifies HIV infection by promoting enhanced virion attachment to target cells.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Prostatic Acid Phosphatase (248-286), or PAP (248-286), is a biologically active peptide and a semen-derived enhancer of viral infection (SEVI) factor present in semen. It significantly amplifies HIV infection by promoting enhanced virion attachment to target cells. |
Synonyms | Prostatic Acid Phosphatase(248-286) |
Sequence | Gly-Ile-His-Lys-Gln-Lys-Glu-Lys-Ser-Arg-Leu-Gln-Gly-Gly-Val-Leu-Val-Asn-Glu-Ile-Leu-Asn-His-Met-Lys-Arg-Ala-Thr-Gln-Ile-Pro-Ser-Tyr-Lys-Lys-Leu-Ile-Met-Tyr |
Sequence Short | GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.