Shopping Cart
- Remove All
Your shopping cart is currently empty
Muscarinic toxin 7 (MT7) is a peptide exhibiting selective, noncompetitive antagonistic activity at the muscarinic M1 receptor [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Muscarinic toxin 7 (MT7) is a peptide exhibiting selective, noncompetitive antagonistic activity at the muscarinic M1 receptor [1]. |
| Molecular Weight | 7472.42 |
| Formula | C322H484N90O98S9 |
| Sequence | Leu-Thr-Cys-Val-Lys-Ser-Asn-Ser-Ile-Trp-Phe-Pro-Thr-Ser-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-Gln-Tyr-Ile-Ser-Pro-Arg-Met-Tyr-Asp-Phe-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Lys-Ala-Glu-Tyr-Arg-Asp-Val-Ile-Asn-Cys-Cys-Gly-Thr-Asp-Lys-Cys-Asn |
| Sequence Short | LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK (Disulfide bridge: Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.