Shopping Cart
- Remove All
- Your shopping cart is currently empty
MmTx2 toxin, extracted from the venom of the coral snake, serves as a modulator of the GABA A receptor, increasing its responsiveness to agonists. This property renders it a useful tool in researching neurological disorders, including epilepsy, schizophrenia, and chronic pain [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | MmTx2 toxin, extracted from the venom of the coral snake, serves as a modulator of the GABA A receptor, increasing its responsiveness to agonists. This property renders it a useful tool in researching neurological disorders, including epilepsy, schizophrenia, and chronic pain [1]. |
Alias | Micrurotoxin 2 |
Molecular Weight | 7185.95 |
Formula | C295H450N94O97S10 |
Sequence | Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-His-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn |
Sequence Short | LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHHGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.