Shopping Cart
- Remove All
- Your shopping cart is currently empty
Micrurotoxin 1 (MmTx1 toxin) acts as an allosteric modulator of GABA A receptors, enhancing the receptor's sensitivity to its agonist [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Micrurotoxin 1 (MmTx1 toxin) acts as an allosteric modulator of GABA A receptors, enhancing the receptor's sensitivity to its agonist [1]. |
Synonyms | Micrurotoxin 1 |
Molecular Weight | 7205 |
Formula | C295H455N95O97S10 |
Sequence | Leu-Thr-Cys-Lys-Thr-Cys-Pro-Phe-Thr-Thr-Cys-Pro-Asn-Ser-Glu-Ser-Cys-Pro-Gly-Gly-Gln-Ser-Ile-Cys-Tyr-Gln-Arg-Lys-Trp-Glu-Glu-His-Arg-Gly-Glu-Arg-Ile-Glu-Arg-Arg-Cys-Val-Ala-Asn-Cys-Pro-Ala-Phe-Gly-Ser-His-Asp-Thr-Ser-Leu-Leu-Cys-Cys-Thr-Arg-Asp-Asn-Cys-Asn |
Sequence Short | LTCKTCPFTTCPNSESCPGGQSICYQRKWEEHRGERIERRCVANCPAFGSHDTSLLCCTRDNCN (Disulfide bridge: Cys3-Cys24,Cys6-Cys11,Cys17-Cys41,Cys45-Cys57,Cys58-Cys63) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.