Your shopping cart is currently empty

Synonyms: OXM-3 acetate, Mazdutide acetate(2259884-03-0 free base), LY-3305677 acetate, IBI-362 acetate
Mazdutide acetate
(2259884-03-0 free base)
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $89 | - | In Stock | |
| 5 mg | $272 | - | In Stock | |
| 10 mg | $455 | - | In Stock | |
| 25 mg | $736 | - | In Stock | |
| 50 mg | $1,172 | - | In Stock |
| Description | Mazdutide acetate is a potent co-agonist of glucagon-like peptide (GLP-1R) and glucagon receptor (GCGR), a gastrin-regulating hormone analog.Mazdutide acetate stimulates insulin secretion from mouse pancreatic islets, and can be used in studies of obesity and type 2 diabetes (T2D). |
| In vitro | In oral glucose tolerance tests of diet-induced obese (DIO) and streptozotocin-induced diabetic mice, a single subcutaneous (SC) dose of Mazdutide acetate(15, 30 nmol/kg;) significantly reduced glucose area under the curve by up to 65%[3]. |
| Synonyms | OXM-3 acetate, Mazdutide acetate(2259884-03-0 free base), LY-3305677 acetate, IBI-362 acetate |
| Sequence | His-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-{Lys(AEEA-AEEA-γGlu-Nonadecanoic acid)}-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-NH₂ |
| Sequence Short | HXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG |
| Storage | Store at low temperature,Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 µL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 µL Tween 80 and mix well until fully clarified.
3) Add 450 µL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.