Shopping Cart
Remove All
  • TargetMol
    Your shopping cart is currently empty

Mazdutide acetate(2259884-03-0 free base)

(Synonyms: OXM-3 acetate, Mazdutide acetate(2259884-03-0 free base), LY-3305677 acetate, IBI-362 acetate) Copy Product Info
🥰Excellent

Synonyms: OXM-3 acetate, Mazdutide acetate(2259884-03-0 free base), LY-3305677 acetate, IBI-362 acetate

Catalog No. T78097L Copy Product Info
Purity: 98.41%
🥰Excellent
Mazdutide acetate is a potent co-agonist of glucagon-like peptide (GLP-1R) and glucagon receptor (GCGR), a gastrin-regulating hormone analog.Mazdutide acetate stimulates insulin secretion from mouse pancreatic islets, and can be used in studies of obesity and type 2 diabetes (T2D).

Mazdutide acetate
(2259884-03-0 free base)

Pack SizePriceUSA StockGlobal StockQuantity
1 mg$89-In Stock
5 mg$272-In Stock
10 mg$455-In Stock
25 mg$736-In Stock
50 mg$1,172-In Stock
For In stock only · Estimated delivery: USA Stock (1-2 days) Global Stock (5-7 days)
Add to Cart
Add to Quotation
For research use only—not for human use. No sales to individuals. Use as intended only.
Questions
TargetMol
View More

Batch Information

Select Batch
Purity:98.41%
Appearance:Solid
Color:White
Contact us for more batch information

Resource Download

Product Introduction

Bioactivity
Description
Mazdutide acetate is a potent co-agonist of glucagon-like peptide (GLP-1R) and glucagon receptor (GCGR), a gastrin-regulating hormone analog.Mazdutide acetate stimulates insulin secretion from mouse pancreatic islets, and can be used in studies of obesity and type 2 diabetes (T2D).
In vitro
In oral glucose tolerance tests of diet-induced obese (DIO) and streptozotocin-induced diabetic mice, a single subcutaneous (SC) dose of Mazdutide acetate(15, 30 nmol/kg;) significantly reduced glucose area under the curve by up to 65%[3].
SynonymsOXM-3 acetate, Mazdutide acetate(2259884-03-0 free base), LY-3305677 acetate, IBI-362 acetate
Chemical Properties
SequenceHis-{Aib}-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Glu-Lys-Lys-Ala-{Lys(AEEA-AEEA-γGlu-Nonadecanoic acid)}-Glu-Phe-Val-Glu-Trp-Leu-Leu-Glu-Gly-Gly-Pro-Ser-Ser-Gly-NH₂
Sequence ShortHXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG
Storage & Solubility Information
StorageStore at low temperature,Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.

Calculator

  • Molarity Calculator
  • Dilution Calculator
  • Reconstitution Calculator
  • Molecular Weight Calculator

In Vivo Formulation Calculator (Clear solution)

Please enter your animal experiment information in the following box and click Calculate to obtain the stock solution preparation method and in vivo formula preparation method:
TargetMol | Animal experiments For example, if the intended dosage is 10 mg/kg for animals weighing 20 g , with a dosing volume of 100 μL per animal, TargetMol | Animal experiments and a total of 10 animals are to be administered, using a formulation of TargetMol | reagent 10% DMSO+ 40% PEG300+ 5% Tween 80+ 45% Saline/PBS/ddH2O , the resulting working solution concentration would be 2 mg/mL.
Stock Solution Preparation:

Dissolve 2 mg of the compound in 100 μL DMSOTargetMol | reagent to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.

Preparation of the In Vivo Formulation:

1) Add 100 μL of the DMSOTargetMol | reagent stock solution to 400 µL PEG300TargetMol | reagent and mix thoroughly until the solution becomes clear.

2) Add 50 µL Tween 80 and mix well until fully clarified.

3) Add 450 µL Saline,PBS or ddH2OTargetMol | reagent and mix thoroughly until a homogeneous solution is obtained.

This example is provided solely to demonstrate the use of the In Vivo Formulation Calculator and does not constitute a recommended formulation for any specific compound. Please select an appropriate dissolution and formulation strategy based on your experimental model and route of administration.
All co-solvents required for this protocol, includingDMSO, PEG300/PEG400, Tween 80, SBE-β-CD, and Corn oil, are available for purchase on the TargetMol website.
1 Enter information below:
mg/kg
g
µL
2 Enter the in vivo formulation:
% DMSO
%
% Tween 80
% Saline/PBS/ddH2O

Dose Conversion

You can also refer to dose conversion for different animals. More Dose Conversion

Tech Support

Please see Inhibitor Handling Instructions for more frequently ask questions. Topics include: how to prepare stock solutions, how to store products, and cautions on cell-based assays & animal experiments, etc

Keywords

Related Tags: Mazdutide acetate(2259884-03-0 free base) in vitro