Your shopping cart is currently empty

Mambalgin-2 (Mamb-2), a venom peptide sourced from the African black mamba, acts as an inhibitor of acid-sensitive ion channels (ASICs). It is utilized in research focused on pain and neurological diseases [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Mambalgin-2 (Mamb-2), a venom peptide sourced from the African black mamba, acts as an inhibitor of acid-sensitive ion channels (ASICs). It is utilized in research focused on pain and neurological diseases [1]. |
| Synonyms | Mamb-2 |
| Molecular Weight | 6540.5 |
| Formula | C272H431N85O83S10 |
| Sequence | Leu-Lys-Cys-Phe-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Thr-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys19,Cys41-Cys49,Cys50-Cys55) |
| Sequence Short | LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge: Cys3-Cys19,Cys41-Cys49,Cys50-Cys55) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.