Shopping Cart
- Remove All
- Your shopping cart is currently empty
Mambalgin-2 (Mamb-2), a venom peptide sourced from the African black mamba, acts as an inhibitor of acid-sensitive ion channels (ASICs). It is utilized in research focused on pain and neurological diseases [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Mambalgin-2 (Mamb-2), a venom peptide sourced from the African black mamba, acts as an inhibitor of acid-sensitive ion channels (ASICs). It is utilized in research focused on pain and neurological diseases [1]. |
Alias | Mamb-2 |
Molecular Weight | 6540.5 |
Formula | C272H431N85O83S10 |
Sequence | Leu-Lys-Cys-Phe-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Thr-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys |
Sequence Short | LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge: Cys3-Cys19,Cys41-Cys49,Cys50-Cys55) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.