Shopping Cart
- Remove All
- Your shopping cart is currently empty
m3-Huwentoxin IV (m3-HwTx-IV) is a potent inhibitor of sodium channels (NaV), with half-maximal inhibitory concentrations (IC50s) of 3.3 nM for hNaV1.7, 6.8 nM for hNaV1.6, 7.2 nM for hNaV1.3, 8.4 nM for hNaV1.1, 11.9 nM for hNaV1.2, and 369 nM for hNaV1.4 in the QPatch assay. It also alleviates spontaneous pain in a rodent model induced by the NaV1.7 activator OD1 in a dose-dependent manner [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | m3-Huwentoxin IV (m3-HwTx-IV) is a potent inhibitor of sodium channels (NaV), with half-maximal inhibitory concentrations (IC50s) of 3.3 nM for hNaV1.7, 6.8 nM for hNaV1.6, 7.2 nM for hNaV1.3, 8.4 nM for hNaV1.1, 11.9 nM for hNaV1.2, and 369 nM for hNaV1.4 in the QPatch assay. It also alleviates spontaneous pain in a rodent model induced by the NaV1.7 activator OD1 in a dose-dependent manner [1]. |
Alias | m3-HwTx-IV |
Molecular Weight | 3985.69 |
Formula | C170H271N53O46S6 |
Sequence | Gly-Cys-Leu-Gly-Ile-Phe-Lys-Ala-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Lys-Leu-Val-Cys-Ser-Arg-Lys-Thr-Arg-Trp-Cys-Lys-Trp-Gln-Ile-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31) |
Sequence Short | GCLGIFKACNPSNDQCCKSSKLVCSRKTRWCKWQI-NH2 (Disulfide bridge: Cys2-Cys17,Cys9-Cys24,Cys16-Cys31) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.