Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin XI (JZTX-XI) is a potent inhibitor of sodium conductance with an IC50 of 124 nM, and it significantly delays the rapid inactivation of Na_v1.5, with an EC50 of 1.18±0.2 μM, when expressed in Chinese hamster ovary (CHO-K1) cells [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin XI (JZTX-XI) is a potent inhibitor of sodium conductance with an IC50 of 124 nM, and it significantly delays the rapid inactivation of Na_v1.5, with an EC50 of 1.18±0.2 μM, when expressed in Chinese hamster ovary (CHO-K1) cells [1]. |
Synonyms | JZTX-XI |
Molecular Weight | 3726.27 |
Formula | C158H234N44O47S7 |
Sequence | Glu-Cys-Arg-Lys-Met-Phe-Gly-Gly-Cys-Ser-Val-Asp-Ser-Asp-Cys-Cys-Ala-His-Leu-Gly-Cys-Lys-Pro-Thr-Leu-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Phe-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
Sequence Short | ECRKMFGGCSVDSDCCAHLGCKPTLKYCAWDGTF-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.