Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin-V, a 29-residue polypeptide from Chilobrachys jingzhao spider venom, selectively inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons, with IC50 values of 27.6 nM and 30.2 nM, respectively. Furthermore, it suppresses Kv4.2 potassium currents in Xenopus laevis oocytes, with an IC50 of 604.2 nM [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin-V, a 29-residue polypeptide from Chilobrachys jingzhao spider venom, selectively inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons, with IC50 values of 27.6 nM and 30.2 nM, respectively. Furthermore, it suppresses Kv4.2 potassium currents in Xenopus laevis oocytes, with an IC50 of 604.2 nM [1]. |
Molecular Weight | 3605.36 |
Formula | C157H243N47O37S7 |
Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Lys-Arg-Ala-Cys-Cys-Glu-Gly-Leu-Arg-Cys-Lys-Leu-Trp-Cys-Arg-Lys-Ile-Ile-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
Sequence Short | YCQKWMWTCDSKRACCEGLRCKLWCRKII-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.