Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin-IX is a C-terminally amidated peptide neurotoxin consisting of 35 amino acid residues. It inhibits both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms of voltage-gated sodium channels, as well as the Kv2.1 channel. However, Jingzhaotoxin-IX does not affect the delayed rectifier potassium channels Kv1.1, Kv1.2, and Kv1.3 [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin-IX is a C-terminally amidated peptide neurotoxin consisting of 35 amino acid residues. It inhibits both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms of voltage-gated sodium channels, as well as the Kv2.1 channel. However, Jingzhaotoxin-IX does not affect the delayed rectifier potassium channels Kv1.1, Kv1.2, and Kv1.3 [1]. |
Molecular Weight | 3953.51 |
Formula | C171H251N49O48S6 |
Sequence | Glu-Cys-Thr-Lys-Leu-Leu-Gly-Gly-Cys-Thr-Lys-Asp-Ser-Glu-Cys-Cys-Pro-His-Leu-Gly-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Gly-Trp-Asp-Gly-Thr-Phe-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29) |
Sequence Short | ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.