Shopping Cart
- Remove All
- Your shopping cart is currently empty
Interleukin-6 Fragment (human) is a pleiotropic cytokine originating from both lymphocytes and non-lymphocytes, encoded by a gene on human chromosome 7 spanning roughly 5 kilobases. This fragment shows promise for use in immune response regulation, acute phase reactions, inflammatory processes, oncology, and hematopoiesis [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Interleukin-6 Fragment (human) is a pleiotropic cytokine originating from both lymphocytes and non-lymphocytes, encoded by a gene on human chromosome 7 spanning roughly 5 kilobases. This fragment shows promise for use in immune response regulation, acute phase reactions, inflammatory processes, oncology, and hematopoiesis [1]. |
Cas No. | 145990-81-4 |
Sequence | Ile-Ile-Thr-Gly-Leu-Leu-Glu-Phe-Glu-Val-Tyr-Leu-Glu-Tyr-Leu-Gln-Asn-Arg-Phe-Glu-Ser-Ser-Glu-Glu-Gln-Ala-Arg-Ala-Val-Gln-Met-Ser-Thr-Lys |
Sequence Short | IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.