Shopping Cart
- Remove All
Your shopping cart is currently empty
Human PTH-(1-31), the 1-31 fragment of human parathyroid hormone, stimulates cAMP release and mildly activates 25-hydroxyvitamin D-1α-hydroxylase. Unlike its full-length counterpart, it promotes bone formation without triggering bone resorption, making it a promising candidate for osteoporosis research [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Human PTH-(1-31), the 1-31 fragment of human parathyroid hormone, stimulates cAMP release and mildly activates 25-hydroxyvitamin D-1α-hydroxylase. Unlike its full-length counterpart, it promotes bone formation without triggering bone resorption, making it a promising candidate for osteoporosis research [1] [2]. |
| Molecular Weight | 3719.3 |
| Formula | C162H269N49O47S2 |
| Cas No. | 157938-23-3 |
| Sequence | Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val |
| Sequence Short | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDV |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.