Shopping Cart
- Remove All
Your shopping cart is currently empty
Helodormin, a vasoactive intestinal peptide (VIP) helodermin-like peptide, is isolated from the venom of the Mexican beaded lizard (Heloderma suspectum). It modulates intracellular signaling by activating adenylyl cyclase, thereby influencing various cellular functions. This compound is used in research to explore the evolution and functions of the helodermin-like and VIP peptide families.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 10 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Helodormin, a vasoactive intestinal peptide (VIP) helodermin-like peptide, is isolated from the venom of the Mexican beaded lizard (Heloderma suspectum). It modulates intracellular signaling by activating adenylyl cyclase, thereby influencing various cellular functions. This compound is used in research to explore the evolution and functions of the helodermin-like and VIP peptide families. |
| Molecular Weight | 3843.5 |
| Formula | C176H285N47O49 |
| Cas No. | 89468-62-2 |
| Sequence | His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2 |
| Sequence Short | HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2 |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.