Shopping Cart
- Remove All
- Your shopping cart is currently empty
Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues for binding to the target. This compound also features an inhibitor cystine knot motif [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Hainantoxin-IV acts as a specific antagonist for tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with His28 and Lys32 being critical residues for binding to the target. This compound also features an inhibitor cystine knot motif [1]. |
Alias | HNTX-IV |
Molecular Weight | 3987.53 |
Formula | C166H257N53O50S6 |
Cas No. | 651782-02-4 |
Sequence | Glu-Cys-Leu-Gly-Phe-Gly-Lys-Gly-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Asn-Leu-Val-Cys-Ser-Arg-Lys-His-Arg-Trp-Cys-Lys-Tyr-Glu-Ile-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31) |
Sequence Short | ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.