Shopping Cart
- Remove All
- Your shopping cart is currently empty
Jingzhaotoxin-V is a peptide that suppresses potassium currents in Xenopus laevis oocytes with an IC50 of 604.2 nM, while targeting both tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Jingzhaotoxin-V is a peptide that suppresses potassium currents in Xenopus laevis oocytes with an IC50 of 604.2 nM, while targeting both tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively [1]. |
Molecular Weight | 3608.12 |
Formula | C154H228N44O45S6 |
Cas No. | 1809149-40-3 |
Sequence | Gly-Cys-Lys-Gly-Phe-Gly-Asp-Ser-Cys-Thr-Pro-Gly-Lys-Asn-Glu-Cys-Cys-Pro-Asn-Tyr-Ala-Cys-Ser-Ser-Lys-His-Lys-Trp-Cys-Lys-Val-Tyr-Leu-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
Sequence Short | GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL-NH2 (Disulfide bonds: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.