Shopping Cart
- Remove All
- Your shopping cart is currently empty
Non-selective galanin receptor agonist (Ki values are 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively). Anticonvulsant; prevents the occurrence of full kindled seizures in rats.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | TBD | 35 days |
Description | Non-selective galanin receptor agonist (Ki values are 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3 respectively). Anticonvulsant; prevents the occurrence of full kindled seizures in rats. |
Synonyms | Galanin (1-29) (rat, mouse) |
Molecular Weight | 3164.499 |
Formula | C141H211N43O41 |
Cas No. | 114547-31-8 |
Relative Density. | no data available |
Sequence | Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 |
Sequence Short | GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: 1 mg/mL (0.32 mM), Sonication is recommended. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.