Shopping Cart
Remove All
Your shopping cart is currently empty
Endothelin-1 (1-31) (Human) TFA, a potent vasoconstrictor and hypertensive agent, originates from chymase-mediated selective hydrolysis of big ET-1 [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Endothelin-1 (1-31) (Human) TFA, a potent vasoconstrictor and hypertensive agent, originates from chymase-mediated selective hydrolysis of big ET-1 [1]. |
| In vitro | Endothelin-1 (1-31) (Human) induces proliferation of human mesangial cells at concentrations of 100 pM to 100 nM over 24 hours and triggers ERK activation at 100 nM within 0 to 10 minutes [2]. |
| In vivo | ET-1 (1-31) (100 nM; single dose) TFA induces constriction of mesenteric arteries in mice, likely mediated by ET A receptors, with potential age-related increases, and notable gender differences observed in chronic diabetes [1]. |
| Molecular Weight | 3742.18 |
| Formula | C164H237F3N38O49S5 |
| Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Sequence Short | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.