Your shopping cart is currently empty

Endothelin-1 (1-31) (Human) TFA, a potent vasoconstrictor and hypertensive agent, originates from chymase-mediated selective hydrolysis of big ET-1 [1].
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Endothelin-1 (1-31) (Human) TFA, a potent vasoconstrictor and hypertensive agent, originates from chymase-mediated selective hydrolysis of big ET-1 [1]. |
| In vitro | Endothelin-1 (1-31) (Human) induces proliferation of human mesangial cells at concentrations of 100 pM to 100 nM over 24 hours and triggers ERK activation at 100 nM within 0 to 10 minutes [2]. |
| In vivo | ET-1 (1-31) (100 nM; single dose) TFA induces constriction of mesenteric arteries in mice, likely mediated by ET A receptors, with potential age-related increases, and notable gender differences observed in chronic diabetes [1]. |
| Molecular Weight | 3742.18 |
| Formula | C164H237F3N38O49S5 |
| Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Sequence Short | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.