Shopping Cart
- Remove All
- Your shopping cart is currently empty
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent, derived from the specific hydrolysis of big ET-1 by chymase [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent, derived from the specific hydrolysis of big ET-1 by chymase [1]. |
Molecular Weight | 3628.16 |
Formula | C162H236N38O47S5 |
Cas No. | 133972-52-8 |
Sequence | Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
Sequence Short | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPY (Disulfide bridge:Cys1-Cys15;Cys3-Cys11) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.