Shopping Cart
- Remove All
- Your shopping cart is currently empty
Defensin HNP-1 Human TFA, a human neutrophil peptide (HNP), plays a role in the early development of atherosclerosis by contributing to endothelial cell dysfunction. Additionally, it has demonstrated broad-spectrum antimicrobial and anti-leishmanial effects [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Defensin HNP-1 Human TFA, a human neutrophil peptide (HNP), plays a role in the early development of atherosclerosis by contributing to endothelial cell dysfunction. Additionally, it has demonstrated broad-spectrum antimicrobial and anti-leishmanial effects [1] [2]. |
Molecular Weight | 3556.05 |
Formula | C152H229F3N44O40S6 |
Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Sequence Short | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.