Shopping Cart
- Remove All
- Your shopping cart is currently empty
Defensin HNP-1 human is a Human neutrophil peptide (HNP) involved in endothelial cell dysfunction during early atherosclerotic development and can regulate the growth of atherosclerosis.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $917 | Backorder | |
5 mg | $2,013 | Backorder |
Description | Defensin HNP-1 human is a Human neutrophil peptide (HNP) involved in endothelial cell dysfunction during early atherosclerotic development and can regulate the growth of atherosclerosis. |
Molecular Weight | 3448.1 |
Formula | C150H228N44O38S6 |
Cas No. | 99287-08-8 |
Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Sequence Short | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.