Shopping Cart
- Remove All
Your shopping cart is currently empty
Citrullinated LL-37 1cit, a modified LL-37 peptide, retains the antiviral properties of its parent compound against human rhinovirus and exhibits antibacterial activity against S. aureus. Furthermore, it diminishes the RV1B-induced expression of pro-inflammatory cytokines, including IL-8, CCL5, and IL-6 mRNA [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Citrullinated LL-37 1cit, a modified LL-37 peptide, retains the antiviral properties of its parent compound against human rhinovirus and exhibits antibacterial activity against S. aureus. Furthermore, it diminishes the RV1B-induced expression of pro-inflammatory cytokines, including IL-8, CCL5, and IL-6 mRNA [1]. |
| Molecular Weight | 4494.25 |
| Formula | C205H339N59O54 |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-{Cit}-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Sequence Short | LLGDFF-{Cit}-KSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.