Shopping Cart
- Remove All
- Your shopping cart is currently empty
C5a Anaphylatoxin (human) is a pro-inflammatory peptide that acts as a leukocyte chemoattractant and is used in research on inflammation and immune responses, including allergic asthma [1] [2].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | C5a Anaphylatoxin (human) is a pro-inflammatory peptide that acts as a leukocyte chemoattractant and is used in research on inflammation and immune responses, including allergic asthma [1] [2]. |
Molecular Weight | 8267.51 |
Formula | C350H578N108O107S8 |
Cas No. | 1816940-05-2 |
Sequence | Thr-Leu-Gln-Lys-Lys-Ile-Glu-Glu-Ile-Ala-Ala-Lys-Tyr-Lys-His-Ser-Val-Val-Lys-Lys-Cys-Cys-Tyr-Asp-Gly-Ala-Cys-Val-Asn-Asn-Asp-Glu-Thr-Cys-Glu-Gln-Arg-Ala-Ala-Arg-Ile-Ser-Leu-Gly-Pro-Arg-Cys-Ile-Lys-Ala-Phe-Thr-Glu-Cys-Cys-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn |
Sequence Short | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR (Disulfide bridge: Cys21-Cys47,Cys22-Cys54,Cys34-Cys55) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.