Your shopping cart is currently empty

Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $319 | Inquiry | Inquiry | |
| 5 mg | $918 | Inquiry | Inquiry |
| Description | Brain Natriuretic Peptide (BNP) (1-32), rat is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).Brain natriuretic peptide (type B natriuretic peptide) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulation. |
| Synonyms | Brain Natriuretic Peptide (BNP) (1-32), rat |
| Molecular Weight | 3452.94 |
| Formula | C146H239N47O44S3 |
| Cas No. | 133448-20-1 |
| Smiles | C([C@@H]1NC(=O)[C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC2=CN=CN2)NC([C@@H](NC([C@@H](NC([C@@H](NC([C@@H](NC([C@H](CC(N)=O)N)=O)CO)=O)CCCCN)=O)CCSC)=O)C)=O)=O)CO)=O)CO)=O)CO)=O)CSSC[C@@H](C(N[C@H](C(NCC(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC3=CC=CC=C3)C(O)=O)=O)CC(C)C)=O)CCCNC(=N)N)=O)CC(C)C)=O)=O)CC(O)=O)=O)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C)NC(=O)CNC(=O)[C@]([C@H](CC)C)(NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(O)=O)NC(=O)[C@]([C@H](CC)C)(NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC1=O)[H])[H])C4=CC=CC=C4 |
| Relative Density. | 1.50 g/cm3 (Predicted) |
| Sequence | Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe (Disulfide bridge: Cys10-Cys26) |
| Sequence Short | NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.