Shopping Cart
- Remove All
- Your shopping cart is currently empty
Biotin-α-Bungarotoxin is a biotinylated form of α-Bungarotoxin, which acts as a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Biotin-α-Bungarotoxin is a biotinylated form of α-Bungarotoxin, which acts as a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) [1]. |
Molecular Weight | 8210.41 |
Formula | C348H543N99O107S12 |
Sequence | {Biotin}-Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Th |
Sequence Short | {Biotin}-IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.