Shopping Cart
Remove All
Your shopping cart is currently empty
Bay 55-9837 acetate is a potent and highly selective VPAC2 agonist(Kd = 0.65 nM) and can be used in type 2 diabetes studies.
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $323 | - | In Stock | |
| 5 mg | $708 | - | In Stock | |
| 10 mg | $953 | - | In Stock | |
| 25 mg | $1,420 | - | In Stock | |
| 50 mg | $1,930 | - | In Stock | |
| 100 mg | $2,610 | - | In Stock |
| Description | Bay 55-9837 acetate is a potent and highly selective VPAC2 agonist(Kd = 0.65 nM) and can be used in type 2 diabetes studies. |
| Targets&IC50 | VPAC2:0.65 nM(Kd) |
| Relative Density. | no data available |
| Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr |
| Sequence Short | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.