Shopping Cart
- Remove All
- Your shopping cart is currently empty
Bay 55-9837 TFA, a potent and highly selective VPAC2 agonist with a dissociation constant (Kd) of 0.65 nM, represents a potential research therapy for type 2 diabetes [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Bay 55-9837 TFA, a potent and highly selective VPAC2 agonist with a dissociation constant (Kd) of 0.65 nM, represents a potential research therapy for type 2 diabetes [1]. |
Molecular Weight | 3456.22 |
Formula | C150H240F3ClN44O44 |
Sequence | His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2 |
Sequence Short | HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2 |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.