Shopping Cart
- Remove All
- Your shopping cart is currently empty
ATX-II TFA, a specific Na+ channel modulator toxin, is derived from the venom of the sea anemone (Anemonia sulcata). This compound impedes the inactivation of Na+ channels and has been associated with arrhythmogenesis in the pulmonary vein and atrial fibrillation [1] [2]. It interacts with halothane, caffeine, and ryanodine in this modulation.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $1,150 | 6-8 weeks | |
5 mg | $2,530 | 6-8 weeks | |
10 mg | $3,800 | 6-8 weeks | |
25 mg | $6,460 | 6-8 weeks |
Description | ATX-II TFA, a specific Na+ channel modulator toxin, is derived from the venom of the sea anemone (Anemonia sulcata). This compound impedes the inactivation of Na+ channels and has been associated with arrhythmogenesis in the pulmonary vein and atrial fibrillation [1] [2]. It interacts with halothane, caffeine, and ryanodine in this modulation. |
Sequence | Gly-Val-Pro-Cys-Leu-Cys-Asp-Ser-Asp-Gly-Pro-Ser-Val-Arg-Gly-Asn-Thr-Leu-Ser-Gly-Ile-Ile-Trp-Leu-Ala-Gly-Cys-Pro-Ser-Gly-Trp-His-Asn-Cys-Lys-Lys-His-Gly-Pro-Thr-Ile-Gly-Trp-Cys-Cys-Lys-Gln (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45) |
Sequence Short | GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ (Disulfide bonds: Cys4-Cys44, Cys6-Cys34, Cys27-Cys45) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.