Shopping Cart
- Remove All
- Your shopping cart is currently empty
Adrenocorticotropic Hormone (ACTH) (1-39), rat, is a potent melanocortin 2 (MC2) receptor agonist. Peptide fragments of ACTH (1-39) were formed during in vitro incubation with membrane preparations, isolated by high-pressure liquid chromatography, and characterized by determining their amino acid composition and NH2-terminal residue.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
1 mg | $198 | Backorder | |
5 mg | $792 | Backorder |
Description | Adrenocorticotropic Hormone (ACTH) (1-39), rat, is a potent melanocortin 2 (MC2) receptor agonist. Peptide fragments of ACTH (1-39) were formed during in vitro incubation with membrane preparations, isolated by high-pressure liquid chromatography, and characterized by determining their amino acid composition and NH2-terminal residue. |
Synonyms | ACTH (1-39) (mouse, rat) |
Molecular Weight | 4582.23 |
Formula | C210H315N57O57S |
Cas No. | 77465-10-2 |
Relative Density. | 1.31g/cm3 |
Sequence | Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
Sequence Short | SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Solubility Information | H2O: Soluble |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.