Shopping Cart
- Remove All
Your shopping cart is currently empty
δ-Buthitoxin-Hj2a, a potent scorpion-venom peptide, acts as a NaV1.1 agonist with an EC50 value of 32 nM and is employed in Dravet syndrome (DS) research [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | δ-Buthitoxin-Hj2a, a potent scorpion-venom peptide, acts as a NaV1.1 agonist with an EC50 value of 32 nM and is employed in Dravet syndrome (DS) research [1]. |
| Targets&IC50 | Nav1.1:32 nM (EC50) |
| Molecular Weight | 7117.96 |
| Formula | C304H458N90O93S8 |
| Sequence | Gly-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr-Thr-Cys-Ala-Lys-Asn-Ser-Tyr-Cys-Asn-Asn-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Leu-Gly-Lys-Tyr-Gly-Asn-Gly-Cys-Trp-Cys-Lys-Asn-Leu-Pro-Asp-Lys-Val-Pro-Ile-Arg-Ile-Pro-Gly-Pro-Cys-Arg |
| Sequence Short | GRDAYIADDKNCVYTCAKNSYCNNECTKNGAESGYCQWLGKYGNGCWCKNLPDKVPIRIPGPCR-NH2 (Disulfide bridge:(Disulfide bridge:Cys12-Cys63;Cys16-Cys36;Cys22-Cys46;Cys26-Cys48) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.