Shopping Cart
Remove All
Your shopping cart is currently empty
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, functions as a potent agonist for the NaV1.1 channel with an EC50 value of 17 nM, and is applicable in research on Dravet syndrome (DS) [1].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | δ-Buthitoxin-Hj1a, a scorpion-venom peptide, functions as a potent agonist for the NaV1.1 channel with an EC50 value of 17 nM, and is applicable in research on Dravet syndrome (DS) [1]. |
| Targets&IC50 | Nav1.1:32 nM (EC50) |
| Molecular Weight | 7482.39 |
| Formula | C326H482N92O96S8 |
| Sequence | Glu-Glu-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Gln-Pro-His-Asn-Cys-Val-Tyr-His-Cys-Phe-Arg-Asp-Ser-Tyr-Cys-Asn-Asp-Leu-Cys-Ile-Lys-His-Gly-Ala-Glu-Ser-Gly-Glu-Cys-Lys-Trp-Phe-Thr-Ser-Ser-Gly-Asn-Ala-Cys-Trp-Cys-Val-Lys-Leu-Pro-Lys-Ser-Glu-Pro-Ile-Lys-Val-Pro-Gly-Lys |
| Sequence Short | EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH (Disulfide bridge:Cys14-Cys65;Cys18-Cys38;Cys24-Cys48;Cys28-Cys50) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.