Shopping Cart
- Remove All
Your shopping cart is currently empty
κ-Bungarotoxin (κ-Bgt) is a selective, potent antagonist of α3β2 neuronal nicotinic acetylcholine receptors, characterized by slow reversibility and an IC50 of 2.30 nM [1].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | κ-Bungarotoxin (κ-Bgt) is a selective, potent antagonist of α3β2 neuronal nicotinic acetylcholine receptors, characterized by slow reversibility and an IC50 of 2.30 nM [1]. |
| Synonyms | κ-Bgt |
| Molecular Weight | 7265.22 |
| Formula | C303H475N91O97S10 |
| Cas No. | 124511-67-7 |
| Sequence | Arg-Thr-Cys-Leu-Ile-Ser-Pro-Ser-Ser-Thr-Pro-Gln-Thr-Cys-Pro-Asn-Gly-Gln-Asp-Ile-Cys-Phe-Leu-Lys-Ala-Gln-Cys-Asp-Lys-Phe-Cys-Ser-Ile-Arg-Gly-Pro-Val-Ile-Glu-Gln-Gly-Cys-Val-Ala-Thr-Cys-Pro-Gln-Phe-Arg-Ser-Asn-Tyr-Arg-Ser-Leu-Leu-Cys-Cys-Thr-Thr-Asp-Asn-Cys |
| Sequence Short | RTCLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTDNCNH (Disulfide bridge:Cys3-Cys21, Cys14-Cys42, Cys27-Cys31, Cys46-Cys58, Cys59-Cys64) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.