Shopping Cart
Remove All
Your shopping cart is currently empty
Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). Prevents opening of nicotinic receptor-associated ion channels and is selective for α7 receptors over α3β4 receptors (IC50 values are 1.6 nM and > 3 μM respectively).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $628 | 35 days | 35 days |
| Description | Neurotoxin that blocks neuromuscular transmission via irreversible inhibition of nicotinic ACh receptors (nAChRs). Prevents opening of nicotinic receptor-associated ion channels and is selective for α7 receptors over α3β4 receptors (IC50 values are 1.6 nM and > 3 μM respectively). |
| Molecular Weight | 7984.14 |
| Formula | C338H529N97O105S11 |
| Cas No. | 11032-79-4 |
| Relative Density. | no data available |
| Sequence | Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys |
| Sequence Short | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG (Disulfide bridge: Cys3-Cys23;Cys16-Cys44;Cys29-Cys33;Cys48-Cys59;Cys60-Cys65) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.