Your shopping cart is currently empty

β-CGRP, human acetate is one of calcitonin peptides and acts via the complex of receptor-activity-modifying protein (RAMP) and calcitonin-receptor-like receptor (CRLR) (IC50s: 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells).

| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 1 mg | $382 | In Stock | In Stock | |
| 5 mg | $861 | In Stock | In Stock | |
| 10 mg | $1,180 | In Stock | In Stock | |
| 25 mg | $1,760 | In Stock | In Stock | |
| 50 mg | $2,370 | In Stock | In Stock | |
| 100 mg | $3,180 | In Stock | In Stock |
| Description | β-CGRP, human acetate is one of calcitonin peptides and acts via the complex of receptor-activity-modifying protein (RAMP) and calcitonin-receptor-like receptor (CRLR) (IC50s: 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells). |
| Targets&IC50 | CRLR/RAMP2:300 nM , CRLR/RAMP1:1 nM |
| In vitro | β-CGRP, human acts via a complex of the CRLR and RAMP, with IC50s of 1 nM in both SK-N-MC and Swiss 3T3 cells express CRLR and RAMP1, and 300 nM and 130 nM in HEK293T and NG108-15 cells expressing CRLR and RAMP2 [1]. CGRP is a potent vasodilator and also exhibits pro- and -anti-inflammatory activity [2]. |
| Synonyms | β-CGRP, human acetate (101462-82-2 free), Human β-CGRP acetate, CGRP-II (Human) (acetate) |
| Relative Density. | no data available |
| Sequence | Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7) |
| Sequence Short | ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.