Shopping Cart
- Remove All
Your shopping cart is currently empty
Urocortin III (mouse) (free acid), a selective high-affinity agonist for the CRF2 receptor, significantly inhibits gastric emptying without affecting colonic transit [1] [2].
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 5 mg | Inquiry | Backorder | |
| 50 mg | Inquiry | Backorder |
| Description | Urocortin III (mouse) (free acid), a selective high-affinity agonist for the CRF2 receptor, significantly inhibits gastric emptying without affecting colonic transit [1] [2]. |
| Molecular Weight | 4171.26 |
| Formula | C186H311N51S2 |
| Sequence Short | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.