Your shopping cart is currently empty

Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide that primarily interacts with and activates the CRF receptor type 2 (CRF-R2), showing a specific distribution in the central nervous system and periphery. It selectively binds to type 2 CRF receptors with dissociation constants (Ki values) of 13.5 nM for mouse CRF2β, 21.7 nM for rat CRF2α, and >100 nM for human CRF1, indicating a strong preference for CRF-R2 over CRF1. Additionally, Urocortin III (human) plays a crucial role in the somatostatin-dependent negative feedback mechanism regulating the secretion of Insulin (human).
| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 500 μg | $663 | 35 days | 35 days | |
| 1 mg | $1,190 | 35 days | 35 days |
| Description | Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide that primarily interacts with and activates the CRF receptor type 2 (CRF-R2), showing a specific distribution in the central nervous system and periphery. It selectively binds to type 2 CRF receptors with dissociation constants (Ki values) of 13.5 nM for mouse CRF2β, 21.7 nM for rat CRF2α, and >100 nM for human CRF1, indicating a strong preference for CRF-R2 over CRF1. Additionally, Urocortin III (human) plays a crucial role in the somatostatin-dependent negative feedback mechanism regulating the secretion of Insulin (human). |
| Molecular Weight | 4137.93 |
| Formula | C185H307N53O50S2 |
| Cas No. | 357952-09-1 |
| Sequence | Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 |
| Sequence Short | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.