Shopping Cart
- Remove All
Your shopping cart is currently empty
This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.

| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 100 mg | Inquiry | Backorder | |
| 500 mg | Inquiry | Backorder |
| Description | This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors. |
| Molecular Weight | 4504.2 |
| Formula | C202H325N61O54S |
| Cas No. | 277302-47-3 |
| Relative Density. | no data available |
| Sequence Short | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.