Your shopping cart is currently empty

TIP39, a neuropeptide and an agonist for the parathyroid hormone receptor type 2 (PTH2R), effectively increases cAMP levels in COS-7 cells featuring recombinant PTH2R from humans or rats (EC50s = 0.5 and 0.8 nM, respectively), as well as in F-11 cells that naturally express PTH2R (EC50 = 1.15 nM). Furthermore, TIP39 at 1 nM halts the cell cycle at the G0/G1 phase and reduces Sox9 expression, a crucial regulator of cartilage differentiation, in CFK2 rat chondrocytes. Additionally, administering 100 pmol/animal of TIP39 reduces the immobility period in the forced swim test in mice, indicating a potential antidepressant effect.

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 1 mg | $141 | Inquiry | Inquiry | |
| 5 mg | $489 | Inquiry | Inquiry | |
| 10 mg | $836 | Inquiry | Inquiry |
| Description | TIP39, a neuropeptide and an agonist for the parathyroid hormone receptor type 2 (PTH2R), effectively increases cAMP levels in COS-7 cells featuring recombinant PTH2R from humans or rats (EC50s = 0.5 and 0.8 nM, respectively), as well as in F-11 cells that naturally express PTH2R (EC50 = 1.15 nM). Furthermore, TIP39 at 1 nM halts the cell cycle at the G0/G1 phase and reduces Sox9 expression, a crucial regulator of cartilage differentiation, in CFK2 rat chondrocytes. Additionally, administering 100 pmol/animal of TIP39 reduces the immobility period in the forced swim test in mice, indicating a potential antidepressant effect. |
| Synonyms | Tuberoinfundibular Peptide of 39 Residues |
| Molecular Weight | 4504.19 |
| Formula | C202H325N61O54S.XCF3COOH |
| Smiles | OC(C(F)(F)F)=O.O=C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@@H](CC(O)=O)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@@H](CCCNC(N)=N)C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC1=CNC=N1)C(N[C@@H](CC2=CNC3=C2C=CC=C3)C(N[C@H](C(N[C@@H](CC(N)=O)C(N[C@@H](CO)C(N[C@@H](CC4=CC=C(O)C=C4)C(N[C@@H](CCSC)C(N[C@@H](CC5=CNC=N5)C(N[C@@H](CCCCN[H])C(N[C@H](C(N[C@H](C(N[C@@H](C(C)C)C(N[C@H](C(N[C@@H](CC(O)=O)C(N[C@H](C(N6CCC[C@H]6C(O)=O)=O)C)=O)=O)CC(C)C)=O)=O)CC(C)C)=O)CC(C)C)=O)=O)=O)=O)=O)=O)=O)CC(C)C)=O)=O)=O)=O)=O)=O)CC(C)C)=O)C)=O)C)=O)CC(C)C)=O)CC(C)C)=O)=O)C)=O)=O)=O)=O)CC7=CC=CC=C7)=O)C)=O)C)=O)=O)=O)C)=O)CC(C)C)=O)C)=O)CC(C)C)[C@H](CO)N[H] |
| Sequence | H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH |
| Sequence Short | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | 20% ACN/H2O: Soluble |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.