Shopping Cart
- Remove All
- Your shopping cart is currently empty
Super-TDU TFA, a specialized YAP antagonist, specifically inhibits the interaction between YAP and TEADs. This compound demonstrates tumor growth suppression in a gastric cancer mouse model [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Super-TDU TFA, a specialized YAP antagonist, specifically inhibits the interaction between YAP and TEADs. This compound demonstrates tumor growth suppression in a gastric cancer mouse model [1]. |
Molecular Weight | 5394.94 |
Formula | C239H371N66O71S |
Sequence Short | SVDDHFAKSLGDTWLQIGGSGNPKTANVPQTVPMRLRKLPDSFFKPPE |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.