Shopping Cart
- Remove All
- Your shopping cart is currently empty
Stromatoxin 1, a peptide isolated from tarantulas, acts as an inhibitor of various potassium channels, including K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3. It selectively targets K(V)2.1 and K(V)2.2 channel subunits, which are crucial in counteracting myogenic and neurogenic contractions of rat urinary bladder smooth muscle (UBSM) [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Stromatoxin 1, a peptide isolated from tarantulas, acts as an inhibitor of various potassium channels, including K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3. It selectively targets K(V)2.1 and K(V)2.2 channel subunits, which are crucial in counteracting myogenic and neurogenic contractions of rat urinary bladder smooth muscle (UBSM) [1]. |
Molecular Weight | 3791.31 |
Formula | C156H237N49O48S7 |
Cas No. | 741738-59-0 |
Sequence | Asp-Cys-Thr-Arg-Met-Phe-Gly-Ala-Cys-Arg-Arg-Asp-Ser-Asp-Cys-Cys-Pro-His-Leu-Gly-Cys-Lys-Pro-Thr-Ser-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28) |
Sequence Short | DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.