Shopping Cart
Remove All
Your shopping cart is currently empty
Ssm Spooky Toxin, derived from Scolopendra mutilans, exhibits potent lethality affecting both hematological and respiratory systems primarily through the inhibition of KCNQ (voltage-gated potassium channel family 7) channels. It demonstrates IC50 values of 2.8 μM for Kv7.4, 5.26 μM for Kv1.3, and 0.1-0.3 M for the Shal channel, respectively. Additionally, this toxin impedes cytokine production by selectively targeting the KV1.3 channel in T cells and is crucial for the centipede's circulatory system functions [1] [2] [3].
| Pack Size | Price | USA Warehouse | Global Warehouse | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Backorder | Backorder | |
| 50 mg | Inquiry | Backorder | Backorder |
| Description | Ssm Spooky Toxin, derived from Scolopendra mutilans, exhibits potent lethality affecting both hematological and respiratory systems primarily through the inhibition of KCNQ (voltage-gated potassium channel family 7) channels. It demonstrates IC50 values of 2.8 μM for Kv7.4, 5.26 μM for Kv1.3, and 0.1-0.3 M for the Shal channel, respectively. Additionally, this toxin impedes cytokine production by selectively targeting the KV1.3 channel in T cells and is crucial for the centipede's circulatory system functions [1] [2] [3]. |
| Targets&IC50 | Kv1.3 channel:5.26±0.56 μM, Kv7.4 channel:2.8±0.25 μM |
| Synonyms | SsTx Toxin |
| Molecular Weight | 6017.84 |
| Formula | C270H413N69O79S4 |
| Sequence | Glu-Val-Ile-Lys-Lys-Asp-Thr-Pro-Tyr-Lys-Lys-Arg-Lys-Phe-Pro-Tyr-Lys-Ser-Glu-Cys-Leu-Lys-Ala-Cys-Ala-Thr-Ser-Phe-Thr-Gly-Gly-Asp-Glu-Ser-Arg-Ile-Gln-Glu-Gly-Lys-Pro-Gly-Phe-Phe-Lys-Cys-Thr-Cys-Tyr-Phe-Thr-Thr-Gly (Disulfide bridge: Cys20-Cys46, Cys24-Cys48 |
| Sequence Short | EVIKKDTPYKKRKFPYKSECLKACATSFTGGDESRIQEGKPGFFKCTCYFTTG (Disulfide bridge: Cys20-Cys46, Cys24-Cys48) |
| Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.