Your shopping cart is currently empty

Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges. It acts as a potent inhibitor of the Kv1.3 potassium channel with an IC 50 value of 63 nM. This compound is regarded as a promising molecular target for the diagnosis and treatment of a range of autoimmune disorders and cancers [1].

| Pack Size | Price | USA Stock | Global Stock | Quantity |
|---|---|---|---|---|
| 5 mg | Inquiry | Inquiry | Inquiry | |
| 50 mg | Inquiry | Inquiry | Inquiry |
| Description | Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges. It acts as a potent inhibitor of the Kv1.3 potassium channel with an IC 50 value of 63 nM. This compound is regarded as a promising molecular target for the diagnosis and treatment of a range of autoimmune disorders and cancers [1]. |
| Targets&IC50 | Kv1.3 channel:63 nM |
| Synonyms | α-KTx6.13, SPX, Potassium channel toxin alpha-KTx 6.13 |
| Molecular Weight | 3700.33 |
| Formula | C147H236N48O46S9 |
| Cas No. | 752984-66-0 |
| Smiles | O=C1N2[C@@](CCC2)(C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@]3(C(=O)N[C@@]([C@H](CC)C)(C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@]4(C(=O)N[C@@H](CCCCN)C(=O)N[C@@]5(C(=O)N[C@@H](CC6=CC=C(O)C=C6)C(=O)NCC(=O)N[C@H](C(N)=O)CSSC[C@@]1(NC(=O)CNC(=O)[C@]([C@@H](C)O)(NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@](CSSC5)(NC(=O)[C@]7(N(C(=O)[C@H](CO)NC(=O)[C@H](CC8=CC=C(O)C=C8)NC(=O)[C@](CSSC4)(NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H](NC([C@@H](NC([C@H]([C@H](CC)C)N)=O)CCCNC(=N)N)=O)CSSC3)[H])CCC7)[H])[H])[H])[H])[H])[H])[H])[H])[H] |
| Sequence | Ile-Arg-Cys-Ser-Gly-Ser-Arg-Asp-Cys-Tyr-Ser-Pro-Cys-Met-Lys-Gln-Thr-Gly-Cys-Pro-Asn-Ala-Lys-Cys-Ile-Asn-Lys-Ser-Cys-Lys-Cys-Tyr-Gly-Cys-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
| Sequence Short | IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
| Storage | Keep away from moisture | Shipping with blue ice/Shipping at ambient temperature. |
Dissolve 2 mg of the compound in 100 μL DMSO
to obtain a stock solution at a concentration of 20 mg/mL . If the required concentration exceeds the compound's known solubility, please contact us for technical support before proceeding.
1) Add 100 μL of the DMSO
stock solution to 400 μL PEG300
and mix thoroughly until the solution becomes clear.
2) Add 50 μL Tween 80 and mix well until fully clarified.
3) Add 450 μL Saline,PBS or ddH2O
and mix thoroughly until a homogeneous solution is obtained.
| Size | Quantity | Unit Price | Amount | Operation |
|---|

Copyright © 2015-2026 TargetMol Chemicals Inc. All Rights Reserved.