Shopping Cart
- Remove All
- Your shopping cart is currently empty
Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges. It acts as a potent inhibitor of the Kv1.3 potassium channel with an IC 50 value of 63 nM. This compound is regarded as a promising molecular target for the diagnosis and treatment of a range of autoimmune disorders and cancers [1].
Pack Size | Price | Availability | Quantity |
---|---|---|---|
5 mg | Inquiry | Backorder | |
50 mg | Inquiry | Backorder |
Description | Spinoxin, a 34-residue peptide neurotoxin extracted from the venom of Heterometrus spinifer, is characterized by four disulfide bridges. It acts as a potent inhibitor of the Kv1.3 potassium channel with an IC 50 value of 63 nM. This compound is regarded as a promising molecular target for the diagnosis and treatment of a range of autoimmune disorders and cancers [1]. |
Targets&IC50 | Kv1.3:63 nM |
Synonyms | α-KTx6.13, SPX, Potassium channel toxin alpha-KTx 6.13 |
Molecular Weight | 3700.33 |
Formula | C147H236N48O46S9 |
Cas No. | 752984-66-0 |
Sequence | Ile-Arg-Cys-Ser-Gly-Ser-Arg-Asp-Cys-Tyr-Ser-Pro-Cys-Met-Lys-Gln-Thr-Gly-Cys-Pro-Asn-Ala-Lys-Cys-Ile-Asn-Lys-Ser-Cys-Lys-Cys-Tyr-Gly-Cys-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
Sequence Short | IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC-NH2 (Disulfide bridge: Cys3-Cys24, Cys9-Cys29, Cys13-Cys31, Cys19-Cys34) |
Storage | keep away from moisture | Powder: -20°C for 3 years | In solvent: -80°C for 1 year | Shipping with blue ice/Shipping at ambient temperature. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.